PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0257s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 519aa    MW: 56783.8 Da    PI: 7.1588
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0257s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.95.8e-30212269260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkg efprsYY+Ct+++C+vkk +er++ d++++e++Y+g+H h+k
  Kalax.0257s0026.1.p 212 TDGYNWRKYGQKHVKGCEFPRSYYKCTHPNCEVKKLLERAH-DGRITEVIYKGTHSHPK 269
                          6***************************************9.***************85 PP

2WRKY102.42.6e-32375433159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+ +d k v++tYeg+Hnh+
  Kalax.0257s0026.1.p 375 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERACHDIKSVITTYEGKHNHD 433
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-26208270IPR003657WRKY domain
SuperFamilySSF1182901.31E-23211270IPR003657WRKY domain
SMARTSM007743.3E-32211269IPR003657WRKY domain
PROSITE profilePS5081122.355212270IPR003657WRKY domain
PfamPF031061.9E-23213268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36360435IPR003657WRKY domain
SuperFamilySSF1182908.76E-29367435IPR003657WRKY domain
PROSITE profilePS5081138.067370435IPR003657WRKY domain
SMARTSM007746.5E-37375434IPR003657WRKY domain
PfamPF031069.2E-25376433IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MDRPLSSPSP FSILDSHFSY SSMNLTNPHS GSDRLGRSGP LAPRFGSSHA AISSPPALTE  60
ATDTVVATVS SIPNVSRYKL MSPAKLPISR SISQYAPPGL SPSSLLDSPV QFCNIKVEPS  120
PTTGTLHKPQ PMLGGLGCTA AASTSCANNS ASVGEIANNS EFGTQSHSSF ASGSSFLLNQ  180
RIEGEKAMPS ATVSPSDQND VRSSSLLDNS STDGYNWRKY GQKHVKGCEF PRSYYKCTHP  240
NCEVKKLLER AHDGRITEVI YKGTHSHPKP QSKRRFSNDA AMGMTDEHLE RFSYQSEEMA  300
LNSQVATPDM DGTSELPSGP PSDEELNDDK YDDDGDDPNS KRRKQDMGIT HFISSVKPIR  360
EPRVVVQTVS EVDILDDGYR WRKYGQKVVK GNPNPRSYYK CTNPGCPVRK HVERACHDIK  420
SVITTYEGKH NHDVPSAKAS NQEAAAVDPY SGYTSNIGSS MQQNDSVTRV SNHYHQRPPD  480
VRNQYHLEDN EGENFRFATP YLSSNAYPQN LGSLLMGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-37206436878Probable WRKY transcription factor 4
2lex_A8e-37206436878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010647039.11e-128PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-121WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM9TMC31e-128M9TMC3_JATCU; Uncharacterized protein
STRINGVIT_19s0090g01720.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.18e-97WRKY family protein